PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00089.36
Common NameAMTR_s00089p00081270, LOC18429933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24295.7 Da    PI: 9.4235
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00089.36genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.92.7e-28959151
                                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                   SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                             krie+++nrqvtf+kRr+gilKKA E+SvLCda+v++++fsstgk++ey++
  evm_27.model.AmTr_v1.0_scaffold00089.36  9 KRIESSTNRQVTFTKRRTGILKKAREISVLCDAKVSLVLFSSTGKMFEYCT 59
                                             79***********************************************96 PP

2K-box77.82.9e-2671165195
                                    K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                                              yq++sg++l++a++e+l+ e+  +kke+en++ ++Rhl+GedL+sL+  eL++Le+ Le ++ ++R+k++
  evm_27.model.AmTr_v1.0_scaffold00089.36  71 YQRTSGNKLWDAQHEHLSAEVGMMKKENENMRVQLRHLMGEDLNSLTAGELNRLEDSLEVGIASVRAKQM 140
                                              78999***************************************************************** PP

                                    K-box  71 ellleqieelqkkekelqeenkaLr 95 
                                              e++++ ++ l+  ++ l+e+nk+L+
  evm_27.model.AmTr_v1.0_scaffold00089.36 141 EHIHSRTQMLKSNKQILEEQNKQLQ 165
                                              ***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.973161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.22E-34295IPR002100Transcription factor, MADS-box
CDDcd002655.88E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.7E-2082166IPR002487Transcription factor, K-box
PROSITE profilePS5129714.32484174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGRGKIEIKR IESSTNRQVT FTKRRTGILK KAREISVLCD AKVSLVLFSS TGKMFEYCTP  60
STSLKDMLGE YQRTSGNKLW DAQHEHLSAE VGMMKKENEN MRVQLRHLMG EDLNSLTAGE  120
LNRLEDSLEV GIASVRAKQM EHIHSRTQML KSNKQILEEQ NKQLQYIMHQ VDGNITELEQ  180
SYHHLQAERD FAAQGPGAFR VQPIQPNLQQ NK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-18271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-18271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-18271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-18271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-18271168Myocyte-specific enhancer factor 2A
3kov_B2e-18271168Myocyte-specific enhancer factor 2A
3kov_I2e-18271168Myocyte-specific enhancer factor 2A
3kov_J2e-18271168Myocyte-specific enhancer factor 2A
3mu6_A2e-18271168Myocyte-specific enhancer factor 2A
3mu6_B2e-18271168Myocyte-specific enhancer factor 2A
3mu6_C2e-18271168Myocyte-specific enhancer factor 2A
3mu6_D2e-18271168Myocyte-specific enhancer factor 2A
3p57_A2e-18271168Myocyte-specific enhancer factor 2A
3p57_B2e-18271168Myocyte-specific enhancer factor 2A
3p57_C2e-18271168Myocyte-specific enhancer factor 2A
3p57_D2e-18271168Myocyte-specific enhancer factor 2A
3p57_I2e-18271168Myocyte-specific enhancer factor 2A
3p57_J2e-18271168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840164.11e-159PREDICTED: floral homeotic protein PMADS 2
SwissprotQ074742e-85MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLW1P2H01e-158W1P2H0_AMBTC; Uncharacterized protein
STRINGVIT_18s0001g01760.t012e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53021222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.13e-66MIKC_MADS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]